MTMR12 anticorps (Middle Region)

N° du produit ABIN631233

Cet anticorps anti-MTMR12 est un anticorps Lapin Polyclonal détectant MTMR12 dans WB. Adapté pour Humain et Souris.

Aperçu rapide pour MTMR12 anticorps (Middle Region) (ABIN631233)

Antigène: MTMR12 (Myotubularin Related Protein 12 (MTMR12))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MTMR12 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-MTMR12 anticorps

Épitope: Middle Region

Specificité: MTMR12 antibody was raised against the middle region of MTMR12

Purification: Affinity purified

Immunogène: MTMR12 antibody was raised using the middle region of MTMR12 corresponding to a region with amino acids RNSARLSSLFPFALLQRHSSKPVLPTSGWKALGDEDDLAKREDEFVDLGD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MTMR12 Blocking Peptide, (ABIN5614873), is also available for use as a blocking control in assays to test for specificity of this MTMR12 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MTMR12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MTMR12

Antigène: MTMR12 (Myotubularin Related Protein 12 (MTMR12))

Autre désignation: MTMR12

Sujet: MTMR12 inactives phosphatase that plays a role as an adapter for the phosphatase myotubularin to regulate myotubularin intracellular location.Phosphatidylinositide 3-kinase-derived membrane-anchored phosphatidylinositides, such as phosphatidylinositol 3-phosphate (PtdIns(3)P), regulate diverse cellular processes.

Poids moléculaire: 86 kDa (MW of target protein)